General Information

  • ID:  hor006658
  • Uniprot ID:  Q23757
  • Protein name:  Red pigment-concentrating prohormone
  • Gene name:  NA
  • Organism:  Callinectes sapidus (Blue crab)
  • Family:  AKH/HRTH/RPCH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Callinectes (genus), Portuninae (subfamily), Portunidae (family), Portunoidea (superfamily), Heterotremata , Eubrachyura , Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031409 pigment binding
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QLNFSPGWGKRAAGASGSNGGVGEAVSGLHPSVGGAPGGVVPPGSSSPGDSCGPIPVSAVMHIYRLIRSEAVRLVQCQDEEYLG
  • Length:  84
  • Propeptide:  MVRRSGVTLLVVALLVVTLMSSVSAQLNFSPGWGKRAAGASGSNGGVGEAVSGLHPSVGGAPGGVVPPGSSSPGDSCGPIPVSAVMHIYRLIRSEAVRLVQCQDEEYLG
  • Signal peptide:  MVRRSGVTLLVVALLVVTLMSSVSA
  • Modification:  T1 Pyrrolidone carboxylic acid;T8 Tryptophan amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This hormone adapts the animal to light backgrounds by stimulating concentration of the pigment of its red body-chromatophores.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q23757-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006658_AF2.pdbhor006658_ESM.pdb

Physical Information

Mass: 982495 Formula: C361H569N107O115S3
Absent amino acids: T Common amino acids: G
pI: 6.5 Basic residues: 7
Polar residues: 33 Hydrophobic residues: 26
Hydrophobicity: -6.79 Boman Index: -7316
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 76.55
Instability Index: 6281.31 Extinction Coefficient cystines: 8605
Absorbance 280nm: 103.67

Literature

  • PubMed ID:  7611999
  • Title:  A highly conserved red pigment-concentrating hormone precursor in the blue crab Callinectes sapidus.